Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 192 (ZNF192) (N-Term) antibody

Details for Product No. ABIN183564
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LD5-1, ZNF192, ZSCAN40, 2510038J07Rik, D430019P06Rik, Zfp192
Epitope
N-Term
(7), (4), (2), (2), (1), (1), (1), (1)
Reactivity
Cow (Bovine), Dog (Canine), Human
(23), (4), (2), (2), (2), (1), (1)
Host
Rabbit
(18), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(24), (9), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183564
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF192
Sequence PSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVF RLRFRQLRYQ
Predicted Reactivity Human : 100 %, Bovine : 70 %, Dog : 70 %, Goat : 70 %
Characteristics This is a rabbit polyclonal antibody against ZNF192. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF192
Background ZNF192 belongs to the krueppel C2H2-type zinc-finger protein family and contains the conserved SCAN box domain. ZNF192 may be involved in transcriptional regulation.
Molecular Weight 66 kDa
Gene ID 7745
NCBI Accession NM_006298, NP_006289
UniProt Q15776
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 578 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 192 (ZNF192) (N-Term) antibody WB Suggested Anti-ZNF192 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Dias Neto, Correa, Verjovski-Almeida et al.: "Shotgun sequencing of the human transcriptome with ORF expressed sequence tags." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 97, Issue 7, pp. 3491-6, 2000 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183564
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top