K(lysine) Acetyltransferase 5 (KAT5) (N-Term) antibody

Details for Product No. ABIN183712
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
AI839539, CPLA2, Htatip, Htatip1, PLIP, Tip55, Tip60, ESA1, HTATIP, HTATIP1, TIP, TIP60, ZC2HC5, cPLA2, im:6908768, wu:fb55b08, zgc:110752, 6121, CG6121, DmEG0007.7, Dmel/TIP60, Dmel\\CG6121, Dmel\\TI ... show more
AI839539, CPLA2, Htatip, Htatip1, PLIP, Tip55, Tip60, ESA1, HTATIP, HTATIP1, TIP, TIP60, ZC2HC5, cPLA2, im:6908768, wu:fb55b08, zgc:110752, 6121, CG6121, DmEG0007.7, Dmel/TIP60, Dmel\\CG6121, Dmel\\TIP60, EG0007.7, EG:EG0007.7, dTIP60, dTip60, dmHAG405 show less
Epitope
N-Term
(9), (8), (7), (7), (5), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(97), (50), (37), (4), (3), (3), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(79), (19)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(65), (49), (35), (11), (10), (8), (7), (5), (4), (3)
Pubmed 1 reference available
Catalog no. ABIN183712
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human HTATIP
Sequence EGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYI DFNKRLDEWV
Predicted Reactivity Zebrafish : 85 %
Characteristics This is a rabbit polyclonal antibody against HTATIP. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name HTATIP
Background HTATIP belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants.
Molecular Weight 62 kDa
Gene ID 10524
NCBI Accession NM_182710, NP_874369
UniProt Q92993-3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 546 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-K(lysine) Acetyltransferase 5 (KAT5) (N-Term) antibody anti-K(lysine) Acetyltransferase 5 (KAT5) (N-Term) antibody
Background publications Murr, Loizou, Yang et al.: "Histone acetylation by Trrap-Tip60 modulates loading of repair proteins and repair of DNA double-strand breaks." in: Nature cell biology, Vol. 8, Issue 1, pp. 91-9, 2006 (PubMed).

Hosts (79), (19)
Reactivities (97), (50), (37), (4), (3), (3), (1), (1), (1), (1), (1), (1), (1)
Applications (65), (49), (35), (11), (10), (8), (7), (5), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (8), (7), (7), (5), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
back to top