Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183726

Zinc Finger Protein 36, C3H Type-Like 2 (ZFP36L2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BRF2, ERF2, ERF-2, TIS11D, RNF162C, Brf2, Tis11d, fi22c11, wu:fi22c11, zgc:76924, ZFP36L2, XC3H-3b, brf2, c3h-3, erf-2, erf2, rnf162c, tis11d
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183726
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZFP36L2 antibody: synthetic peptide directed towards the N terminal of human ZFP36L2
Sequence MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPV AAAPSSGFAP
Predicted Reactivity Bovine : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against ZFP36L2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZFP36L2
Background ZFP36L2 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
Molecular Weight 51kDa
Gene ID 678
NCBI Accession NP_008818, NM_006887
UniProt Q53TB4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZFP36L2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Hudson, Martinez-Yamout, Dyson et al.: "Recognition of the mRNA AU-rich element by the zinc finger domain of TIS11d." in: Nature structural & molecular biology, Vol. 11, Issue 3, pp. 257-64, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 36, C3H Type-Like 2 (ZFP36L2)", type "Antibodies"
Hosts (21), (1)
Reactivities (22), (18), (14), (12), (11), (1)
Applications (13), (9), (6), (3), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1), (1)
Beacon