Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 36, C3H Type-Like 2 (ZFP36L2) (N-Term) antibody

Details for Product No. ABIN183726
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BRF2, ERF2, ERF-2, TIS11D, RNF162C, Brf2, Tis11d, fi22c11, wu:fi22c11, zgc:76924, ZFP36L2, XC3H-3b, brf2, c3h-3, erf-2, erf2, rnf162c, tis11d
Epitope
N-Term
(7), (6), (3), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(28), (16), (14), (12), (11), (1)
Host
Rabbit
(27), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (11), (9), (8), (3), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183726
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZFP36L2
Sequence MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPV AAAPSSGFAP
Predicted Reactivity Bovine : 100 %, Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against ZFP36L2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ZFP36L2
Background ZFP36L2 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
Molecular Weight 51 kDa
Gene ID 678
NCBI Accession NM_006887, NP_008818
UniProt Q53TB4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 494 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 36, C3H Type-Like 2 (ZFP36L2) (N-Term) antibody WB Suggested Anti-ZFP36L2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Hudson, Martinez-Yamout, Dyson et al.: "Recognition of the mRNA AU-rich element by the zinc finger domain of TIS11d." in: Nature structural & molecular biology, Vol. 11, Issue 3, pp. 257-64, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183726
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top