Apoptosis Antagonizing Transcription Factor (AATF) antibody

Antigen: Apoptosis Antagonizing Transcription Factor (AATF)

Synonyms: DED, CHE1, CHE-1, Trb, Che-1, MGC35916, 4933415H02Rik, 5830465M17Rik, Ded, AATF, ded, che1, che-1, cb109, sb:cb109, wu:fc13d05, zgc:162071

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN183737

Additional Information

Alternative name: AATF

Gene ID: AATF

UniProt: Q9NY61

Immunogen: The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF

Sequence: MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRF DEGEDGEGDF

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-AATF antibody concentration is 1 mg/ml.

Description: The AATF is a protein that was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. AATF contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of AATF interfered with MAP3K12 induced apoptosis.The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.

Characteristics: Antigen Size: 560 amino acids

Molecular Weight: 63kDa

Application Details

Application Notes: WB Suggested Anti-AATF Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Daudi cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-AATF Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Daudi cell lysate

Publications

Product: Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).