Tripartite Motif Containing 32 (TRIM32) (N-Term) antibody

Details for Product No. ABIN183741
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms HT2A, BBS11, TATIP, LGMD2H, 3f3, Zfp117, 1810045E12Rik, TRIM32
Epitope
N-Term
(5), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(32), (18), (18), (3), (3), (3)
Host
Rabbit
(27), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(22), (10), (7), (7), (6), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183741
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TRIM32
Sequence MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCG HTICRQCLEK
Predicted Reactivity Bovine : 92 %, Dog : 92 %, Guinea pig : 92 %, Horse : 92 %, Human : 92 %, Mouse : 92 %, Pig : 92 %, Rabbit : 92 %, Rat : 92 %, Chicken : 82 %
Characteristics This is a rabbit polyclonal antibody against TRIM32. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TRIM32
Background TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
Molecular Weight 72 kDa
Gene ID 22954
NCBI Accession NM_012210, NP_036342
UniProt Q13049
Research Area Proteolysis / Ubiquitin, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 653 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 32 (TRIM32) (N-Term) antibody WB Suggested Anti-TRIM32 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Chiang, Beck, Yen et al.: "Homozygosity mapping with SNP arrays identifies TRIM32, an E3 ubiquitin ligase, as a Bardet-Biedl syndrome gene (BBS11)." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 16, pp. 6287-92, 2006 (PubMed).

Hosts (27), (5)
Reactivities (32), (18), (18), (3), (3), (3)
Applications (22), (10), (7), (7), (6), (3), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (2), (1), (1), (1), (1)
back to top