Kelch-Like ECH-Associated Protein 1 (KEAP1) antibody
| Antigen | Kelch-Like ECH-Associated Protein 1 (KEAP1) |
| Synonyms | INrf2, KLHL19, MGC1114, MGC4407, MGC9454, KIAA0132, MGC10630, MGC20887, INRF2, mKIAA0132, Inrf2, keap1, fb36f11, MGC136521, wu:fb36f11, KEAP1, MGC79519, klhl19, FLJ12949, DKFZp469D1319 |
| Clonality | Polyclonal |
| Host |
Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Xenopus laevis |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
![]() |
1 reference available |
| Catalog no. | ABIN183745 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | KEAP1 |
| Gene ID | KEAP1 |
| UniProt | Q14145 |
| Immunogen | The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1 |
| Sequence | HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCR KQIDQQNCTC |
| Cross-Reactivity | Cow (Bovine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-KEAP1 antibody concentration is 1 mg/ml. |
| Description | KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene. |
| Characteristics | Antigen Size: 624 amino acids |
| Molecular Weight | 70kDa |
Application Details
| Application Notes |
WB Suggested Anti-KEAP1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Transfected 293T. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-KEAP1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Transfected 293T anti-Kelch-Like ECH-Associated Protein 1 (KEAP1) antibody (Image 2) |
Publications
| Product |
Padmanabhan, Tong, Ohta et al.: "Structural basis for defects of Keap1 activity provoked by its point mutations in lung cancer." in: Molecular cell, Vol. 21, Issue 5, pp. 689-700, 2006 (PubMed).
|
Alternatives
Alternatives for antigen "Kelch-Like ECH-Associated Protein 1 (KEAP1)", type "Antibodies"
| Hosts | Rabbit (39), Mouse (8), Goat (2) |
| Reactivities | Human (49), Mouse (Murine) (34), Rat (Rattus) (30), Cow (Bovine) (24), Dog (Canine) (23), Pig (Porcine) (23), Zebrafish (2), Cat (Feline) (1), Chicken (1), Rabbit (1), Xenopus laevis (1) |
| Applications | Western Blotting (WB) (33), Immunofluorescence (IF) (22), ELISA (20), Immunohistochemistry (IHC) (17), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Flow Cytometry (FACS) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (3), Immunocytochemistry (ICC) (2), Immunoelectron Microscopy (IEM) (1) |
| Conjugates | Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1) |
| Epitopes | C-Term (8), AA 380-624 (1), AA 97-244 (1), N-Term (1), N-Term,Internal Region,AA 41-53 (1) |




Alternatives