Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183826

PiggyBac Transposable Element Derived 1 (PGBD1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SCAND4, HUCEP-4, dJ874C20.4, 4921509E05Rik, PGBD1, DKFZp469J1439
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Fruit Fly (Drosophila melanogaster), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN183826
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PGBD1 antibody: synthetic peptide directed towards the C terminal of human PGBD1
Sequence PQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYS ILVSYMIDVA
Predicted Reactivity Bovine : 100%, Human : 100%, Pig : 100%, Horse : 92%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against PGBD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PGBD1
Background PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known.
Molecular Weight 93kDa
Gene ID 84547
NCBI Accession NP_115896, NM_032507
UniProt Q96JS3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PGBD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Background publications Breunig, Mackedonski, Hollenberg: "Transcription of the bacterial beta-lactamase gene in Saccharomyces cerevisiae." in: Gene, Vol. 20, Issue 1, pp. 1-10, 1983 (PubMed).

Alternatives for antigen "PiggyBac Transposable Element Derived 1 (PGBD1)", type "Antibodies"
Hosts (31), (5), (3)
Reactivities (37), (2), (1)
Applications (25), (15), (10), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (3), (2), (1), (1), (1), (1), (1)
Beacon