PiggyBac Transposable Element Derived 1 (PGBD1) (C-Term) antibody

Details for Product No. ABIN183826
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SCAND4, HUCEP-4, dJ874C20.4, 4921509E05Rik, PGBD1, DKFZp469J1439
Epitope
C-Term
(4), (4), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Fruit Fly (Drosophila melanogaster), Human
(39), (2), (1)
Host
Rabbit
(34), (3), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(27), (14), (10), (4), (3), (2)
Pubmed 2 references available
Catalog no. ABIN183826
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PGBD1
Sequence PQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYS ILVSYMIDVA
Predicted Reactivity Bovine : 100 %, Human : 100 %, Pig : 100 %, Horse : 90 %, Guinea pig : 70 %
Characteristics This is a rabbit polyclonal antibody against PGBD1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PGBD1
Background PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known.
Molecular Weight 93 kDa
Gene ID 84547
NCBI Accession NM_032507, NP_115896
UniProt Q96JS3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 809 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PiggyBac Transposable Element Derived 1 (PGBD1) (C-Term) antibody WB Suggested Anti-PGBD1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Background publications Breunig, Mackedonski, Hollenberg: "Transcription of the bacterial beta-lactamase gene in Saccharomyces cerevisiae." in: Gene, Vol. 20, Issue 1, pp. 1-10, 1983 (PubMed).

Hosts (34), (3), (3)
Reactivities (39), (2), (1)
Applications (27), (14), (10), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (4), (2), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top