Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A) (Middle Region) antibody

Details for Product No. ABIN183894
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C15orf1, HPPCn, I1PP2A, LANP, MAPM, PHAP1, PHAPI, PP32, pp32, Anp32, W91701, zgc:55516, wu:fj36e08, ANP32D, Anp32a, CG5784, CT18148, CT42180, Dmel\\CG5784, anon-EST:fe3A2, ANP32A
Epitope
Middle Region
(13), (7), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(75), (29), (26), (13), (13), (12), (1), (1), (1)
Host
Rabbit
(59), (19)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(66), (35), (27), (19), (12), (10), (10), (5), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN183894
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ANP32A
Sequence FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDA EGYVEGLDDE
Predicted Reactivity Human : 100 %, Mouse : 90 %, Rat : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against ANP32A. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name ANP32A
Background ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.
Molecular Weight 29 kDa
Gene ID 8125
NCBI Accession NM_006305, NP_006296
UniProt P39687
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 249 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A) (Middle Region) antibody WB Suggested Anti-ANP32A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
anti-Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A) (Middle Region) antibody (2) anti-Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A) (Middle Region) antibody (Image 2)
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Hosts (59), (19)
Reactivities (75), (29), (26), (13), (13), (12), (1), (1), (1)
Applications (66), (35), (27), (19), (12), (10), (10), (5), (3), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (7), (2), (2), (2), (2), (1), (1), (1), (1), (1)
back to top