Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183894

Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C15orf1, HPPCn, I1PP2A, LANP, MAPM, PHAP1, PHAPI, PP32, pp32, Anp32, W91701, zgc:55516, wu:fj36e08, ANP32D, Anp32a, CG5784, CT18148, CT42180, Dmel\\CG5784, anon-EST:fe3A2, ANP32A
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183894
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A
Sequence FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDA EGYVEGLDDE
Predicted Reactivity Human : 100%, Mouse : 92%, Rat : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against ANP32A. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name ANP32A
Background ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.
Molecular Weight 29kDa
Gene ID 8125
NCBI Accession NP_006296, NM_006305
UniProt P39687
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ANP32A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A)", type "Antibodies"
Hosts (67), (18)
Reactivities (81), (28), (26), (15), (13), (12), (2), (1), (1), (1), (1), (1)
Applications (73), (34), (29), (19), (12), (10), (10), (3), (2), (2), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (7), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Beacon