Did you know that you can buy products from over 140 different suppliers from us?

Ribosomal Protein L32 (RPL32) (N-Term) antibody

Details for Product No. ABIN183902
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms L32, AU020185, rpL32-3A, zgc:136952, 143250_at, BcDNA:RH03940, CG7939, Dmel\\CG7939, M(3)99D, RP-49, RP49, RPL32, Rp-49, Rp49, Rp49/RpL32, Rpl32, bs30a02.y1, rp49, rp49/RpL32
Epitope
N-Term
(3), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(9), (4), (2)
Host
Rabbit
(6), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (7)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183902
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RPL32
Sequence AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGI DNRVRRRFKG
Predicted Reactivity Human : 100 %, Mouse : 100 %, African clawed frog : 90 %, Zebrafish : 90 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against RPL32. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name RPL32
Background RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding the same protein have been observed for this gene.
Molecular Weight 15 kDa
Gene ID 6161
NCBI Accession NM_000994, NP_000985
UniProt P62910
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 135 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal Protein L32 (RPL32) (N-Term) antibody WB Suggested Anti-RPL32 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Dias Neto, Correa, Verjovski-Almeida et al.: "Shotgun sequencing of the human transcriptome with ORF expressed sequence tags." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 97, Issue 7, pp. 3491-6, 2000 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183902
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top