Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183902

Ribosomal Protein L32 (RPL32) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms L32, AU020185, rpL32-3A, zgc:136952, 143250_at, BcDNA:RH03940, CG7939, Dmel\\CG7939, M(3)99D, RP-49, RP49, RPL32, Rp-49, Rp49, Rp49/RpL32, Rpl32, bs30a02.y1, rp49, rp49/RpL32
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183902
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RPL32 antibody: synthetic peptide directed towards the N terminal of human RPL32
Sequence AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGI DNRVRRRFKG
Predicted Reactivity Human : 100%, Mouse : 100%, African clawed frog : 92%, Zebrafish : 92%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against RPL32. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name RPL32
Background RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding the same protein have been observed for this gene.
Molecular Weight 15kDa
Gene ID 6161
NCBI Accession NP_000985, NM_000994
UniProt P62910
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RPL32 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dias Neto, Correa, Verjovski-Almeida et al.: "Shotgun sequencing of the human transcriptome with ORF expressed sequence tags." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 97, Issue 7, pp. 3491-6, 2000 (PubMed).

Alternatives for antigen "Ribosomal Protein L32 (RPL32)", type "Antibodies"
Hosts (6), (5)
Reactivities (9), (4), (2)
Applications (7), (7)
Epitopes (4), (1), (1), (1)
Beacon