Exosome Component 10 (EXOSC10) (C-Term) antibody

Details for Product No. ABIN183903
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
p2, p3, p4, RRP6, PMSCL, Rrp6p, PM-Scl, PMSCL2, PM/Scl-100, Pmscl2, zgc:55695, pm-scl, pm/scl-100, pmscl, pmscl2, rrp6, rrp6p, EXOSC10, 201.t00018, 21.m02990, DDBDRAFT_0203581, DDBDRAFT_0233752, DDB_0 ... show more
p2, p3, p4, RRP6, PMSCL, Rrp6p, PM-Scl, PMSCL2, PM/Scl-100, Pmscl2, zgc:55695, pm-scl, pm/scl-100, pmscl, pmscl2, rrp6, rrp6p, EXOSC10, 201.t00018, 21.m02990, DDBDRAFT_0203581, DDBDRAFT_0233752, DDB_0203581, DDB_0233752 show less
Epitope
C-Term
(2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
(22), (16), (16), (14), (12), (12)
Host
Rabbit
(22), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(14), (10), (7), (5), (4), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183903
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human EXOSC10
Sequence FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSM SFPTGKSDRG
Predicted Reactivity Horse : 92 %, Dog : 82 %, Mouse : 82 %, Rabbit : 82 %, African clawed frog : 72 %, Bovine : 72 %
Characteristics This is a rabbit polyclonal antibody against EXOSC10. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name EXOSC10
Background EXOSC10 contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.
Molecular Weight 97 kDa
Gene ID 5394
NCBI Accession NM_001001998, NP_001001998
UniProt Q01780
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 885 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Exosome Component 10 (EXOSC10) (C-Term) antibody WB Suggested Anti-EXOSC10 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
anti-Exosome Component 10 (EXOSC10) (C-Term) antibody (2) anti-Exosome Component 10 (EXOSC10) (C-Term) antibody (Image 2)
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Hosts (22), (2)
Reactivities (22), (16), (16), (14), (12), (12)
Applications (14), (10), (7), (5), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
back to top