Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183903

Exosome Component 10 (EXOSC10) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
p2, p3, p4, RRP6, PMSCL, Rrp6p, PM-Scl, PMSCL2, PM/Scl-100, Pmscl2, zgc:55695, pm-scl, pm/scl-100, pmscl, pmscl2, rrp6, rrp6p, EXOSC10, 201.t00018, 21.m02990, DDBDRAFT_0203581, DDBDRAFT_0233752, DDB_0 ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183903
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C terminal of human EXOSC10
Sequence FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSM SFPTGKSDRG
Predicted Reactivity Horse : 92%, Dog : 85%, Mouse : 85%, Rabbit : 85%, African clawed frog : 78%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against EXOSC10. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name EXOSC10
Background EXOSC10 contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.
Molecular Weight 97kDa
Gene ID 5394
NCBI Accession NP_001001998, NM_001001998
UniProt Q01780
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EXOSC10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Alternatives for antigen "Exosome Component 10 (EXOSC10)", type "Antibodies"
Hosts (22), (2)
Reactivities (22), (15), (15), (14), (12), (12)
Applications (14), (10), (7), (5), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1)
Beacon