LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) antibody

Antigen: LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2)

Synonyms: LSM2, Lsm2, G7b, SmX5, Dmapl, Sm-X5, snRNP, Dmpkap, MGC13889, D17H6S56E2, D17H6S56E-2, C6orf28, YBL026W, lsm2, wu:fe48h10, zgc:101795, 18.m06211, 18.m06235

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Xenopus laevis, Zebrafish

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184054

Additional Information

Alternative name: LSM2

Gene ID: LSM2

UniProt: Q9Y333

Immunogen: The immunogen for anti-LSM2 antibody: synthetic peptide directed towards the middle region of human LSM2

Sequence: TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDA ARKEALQQKQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-LSM2 antibody concentration is 1 mg/ml.

Description: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2, MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM].

Characteristics: Antigen Size: 95 amino acids

Molecular Weight: 10kDa

Application Details

Application Notes: WB Suggested Anti-LSM2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-LSM2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

anti-LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) antibody (Image 2)

anti-LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) antibody (Image 3)

Publications

Product: Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).