UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) (N-Term) antibody

Details for Product No. ABIN184059
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HUPF3B, MRXS14, RENT3B, UPF3X, 5730594O13Rik, AI317193, AW541158, RGD1560264
Epitope
N-Term
(2), (2), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(9), (2), (1), (1)
Host
Rabbit
(9)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(8), (3), (2)
Pubmed 1 reference available
Quantity 100 μg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184059
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human UPF3B
Sequence MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQ DRNKEKKEAL
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against UPF3B. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name UPF3B
Background UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctionsThis gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.
Molecular Weight 52 kDa
Gene ID 65109
NCBI Accession NP_075386, NM_023010
UniProt Q9BZI7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 470 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) (N-Term) antibody WB Suggested Anti-UPF3B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) (N-Term) antibody (2) anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) (N-Term) antibody (Image 2)
anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) (N-Term) antibody (3) WB Suggested Anti-UPF3B
Antibody Titration: 1.25 µg/mL ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Validation Images
Did you look for something else?
back to top