UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) antibody

Antigen: UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184059

Additional Information

Alternative name: UPF3B / RENT3B

Gene ID: UPF3B

Immunogen: The immunogen for anti-UPF3B antibody: synthetic peptide directed towards the N terminal of human UPF3B

Sequence: MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQ DRNKEKKEAL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-UPF3B antibody concentration is 1 mg/ml.

Description: UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctionsThis gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.

Characteristics: Antigen Size: 470 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-UPF3B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-UPF3B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) antibody (Image 2)

Publications

Product: Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).