THO Complex 3 (THOC3) (Middle Region) antibody

Details for Product No. ABIN184069
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms THO3, hTREX45, AL033344, 2410044K02Rik, zgc:100815, THOC3
Epitope
Middle Region
(2), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(9), (2), (2), (1), (1), (1), (1)
Host
Rabbit
(8), (3)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(11), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN184069
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human THOC3
Sequence PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISW NNDNNMFFLT
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against THOC3. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name THOC3
Background THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.TEX1 is part of the TREX (transcription/export) complex, which includes THO2 (MIM 300395), HPR1 (MIM 606930), ALY (MIM 604171), and UAP56 (MIM 606390).
Molecular Weight 39 kDa
Gene ID 84321
NCBI Accession NM_032361, NP_115737
UniProt Q96J01
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 351 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-THO Complex 3 (THOC3) (Middle Region) antibody WB Suggested Anti-THOC3 Antibody Titration: 0.25ug/ml
Positive Control: HepG2 cell lysate
anti-THO Complex 3 (THOC3) (Middle Region) antibody (2) anti-THO Complex 3 (THOC3) (Middle Region) antibody (Image 2)
anti-THO Complex 3 (THOC3) (Middle Region) antibody (3) anti-THO Complex 3 (THOC3) (Middle Region) antibody (Image 3)
Product cited in: Strässer, Masuda, Mason et al.: "TREX is a conserved complex coupling transcription with messenger RNA export." in: Nature, Vol. 417, Issue 6886, pp. 304-8, 2002 (PubMed).

Hosts (8), (3)
Reactivities (9), (2), (2), (1), (1), (1), (1)
Applications (11), (2), (2), (1), (1)
Epitopes (2), (2), (2), (2), (1), (1), (1)
back to top