Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184069

THO Complex 3 (THOC3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms THO3, hTREX45, AL033344, 2410044K02Rik, zgc:100815, THOC3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184069
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-THOC3 antibody: synthetic peptide directed towards the middle region of human THOC3
Sequence PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISW NNDNNMFFLT
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against THOC3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name THOC3
Background THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.TEX1 is part of the TREX (transcription/export) complex, which includes THO2 (MIM 300395), HPR1 (MIM 606930), ALY (MIM 604171), and UAP56 (MIM 606390).
Molecular Weight 39kDa
Gene ID 84321
NCBI Accession NP_115737, NM_032361
UniProt Q96J01
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-THOC3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Strässer, Masuda, Mason et al.: "TREX is a conserved complex coupling transcription with messenger RNA export." in: Nature, Vol. 417, Issue 6886, pp. 304-8, 2002 (PubMed).

Alternatives for antigen "THO Complex 3 (THOC3)", type "Antibodies"
Hosts (8), (3)
Reactivities (9), (2), (2), (1), (1), (1), (1)
Applications (11), (2), (2), (1), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1)
Beacon