Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B) antibody

Antigen

Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B)

Synonyms CDC25B, AI604853
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus), Pig (Porcine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN184115
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name CDC25B
Gene ID CDC25B
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B
Sequence TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRAS ESSLSSESSE
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CDC25B antibody concentration is 1 mg/ml.
Description CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined.CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist.
Characteristics Antigen Size: 580 amino acids
Molecular Weight 65kDa

Application Details

Application Notes WB Suggested Anti-CDC25B Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cell Cycle, Cancer, Kinases/Phosphatases
Restrictions For Research Use only

Publications

Product Mirey, Chartrain, Froment et al.: "CDC25B phosphorylated by pEg3 localizes to the centrosome and the spindle poles at mitosis." in: Cell cycle (Georgetown, Tex.), Vol. 4, Issue 6, pp. 806-11, 2005 (PubMed).

Alternatives

Alternatives for antigen "Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B)", type "Antibodies"
Hosts Rabbit (99), Mouse (5), Chicken (1)
Reactivities Human (98), Mouse (Murine) (62), Rat (Rattus) (62), Dog (Canine) (21), Cow (Bovine) (20), Pig (Porcine) (20), Cat (Feline) (1), Chicken (1)
Applications Immunofluorescence (IF) (54), Western Blotting (WB) (54), ELISA (42), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (21), Immunohistochemistry (IHC) (19), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (6), Immunoprecipitation (IP) (5), Immunocytochemistry (ICC) (2), Immunoelectron Microscopy (IEM) (2)
Conjugates Alexa Fluor 350 (5), Alexa Fluor 488 (5), Alexa Fluor 555 (5), Alexa Fluor 647 (5), PE,Cy5.5 (4), Biotin (3), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), Alexa Flour 488 (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Ser149 (12), pSer149 (7), pSer186 (7), pSer353 (7), pSer323 (6), N-Term (4), Internal Region (3), Ser353 (2), pSer187 (2), AA 140-185 (1), C-Term (1), Center (1), N-Term, Ala166 (1), pSer124 (1)