Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184143

Fas (TNFRSF6)-Associated Via Death Domain (FADD) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MORT1, Mort1/FADD, Mort1, TNFRSF6
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184143
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FADD antibody: synthetic peptide directed towards the C terminal of human FADD
Sequence AHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSW NSDASTSEAS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against FADD. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name FADD
Background The protein encoded by FADD is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade.
Molecular Weight 23kDa
Gene ID 8772
NCBI Accession NP_003815, NM_003824
UniProt Q13158
Research Area Cancer, Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FADD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Thomas, Henson, Reed et al.: "Direct binding of Fas-associated death domain (FADD) to the tumor necrosis factor-related apoptosis-inducing ligand receptor DR5 is regulated by the death effector domain of FADD." in: The Journal of biological chemistry, Vol. 279, Issue 31, pp. 32780-5, 2004 (PubMed).

Alternatives for antigen "Fas (TNFRSF6)-Associated Via Death Domain (FADD)", type "Antibodies"
Hosts (113), (43), (2)
Reactivities (123), (53), (31), (12), (2), (1), (1), (1)
Applications (111), (73), (40), (29), (25), (21), (8), (3), (2), (2), (1), (1), (1)
Conjugates (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Epitopes (30), (23), (9), (8), (8), (4), (2), (2), (1), (1)
Beacon