Did you know that you can buy products from over 140 different suppliers from us?

Regulator of G-Protein Signaling 10 (RGS10) (Middle Region) antibody

Details for Product No. ABIN184197
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310010N19Rik, MGC82511, RGS10
Epitope
Middle Region
(7), (3), (2), (1), (1), (1), (1)
Reactivity
Human
(22), (13), (10), (2), (1), (1)
Host
Rabbit
(22), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(24), (10), (8), (4), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN184197
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RGS10
Sequence DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTA AKRASRIYNT
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 90 %, Rat : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against RGS10. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name RGS10
Background Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 21 kDa
Gene ID 6001
NCBI Accession NM_001005339, NP_001005339
UniProt Q96GN0
Research Area Signaling, Immunology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 181 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Regulator of G-Protein Signaling 10 (RGS10) (Middle Region) antibody anti-Regulator of G-Protein Signaling 10 (RGS10) (Middle Region) antibody
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184197
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top