Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184197

Regulator of G-Protein Signaling 10 (RGS10) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310010N19Rik, MGC82511, RGS10
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184197
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RGS10 antibody: synthetic peptide directed towards the middle region of human RGS10
Sequence DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTA AKRASRIYNT
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 90%, Rat : 90%, Bovine : 81%
Characteristics This is a rabbit polyclonal antibody against RGS10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name RGS10
Background Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 21kDa
Gene ID 6001
NCBI Accession NP_001005339, NM_001005339
UniProt Q96GN0
Research Area Signaling, Immunology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RGS10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Regulator of G-Protein Signaling 10 (RGS10)", type "Antibodies"
Hosts (18), (3), (1)
Reactivities (18), (10), (8), (2), (1)
Applications (20), (9), (5), (4), (2), (1)
Epitopes (5), (3), (2), (1), (1), (1)
Beacon