Programmed Cell Death 4 (Neoplastic Transformation Inhibitor) (PDCD4) (N-Term) antibody

Details for Product No. ABIN184208
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms H731, Ma3, Tis, D19Ucla1, Dug, h731, MGC69337, PDCD4
Epitope
N-Term
(24), (23), (10), (10), (10), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(136), (85), (85), (11), (6), (3), (3), (2), (1)
Host
Rabbit
(108), (22), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(117), (80), (46), (34), (12), (10), (6), (5), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN184208
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PDCD4
Sequence MTKYPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSIN EARINAKAKR
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Goat : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against PDCD4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PDCD4
Background PDCD4 is a protein localized to the nucleus in proliferating cells. Expression of this gene is modulated by cytokines in natural killer and T cells. The gene product is thought to play a role in apoptosis but the specific role has not yet been determined. Two transcripts encoding different isoforms have been identified.
Molecular Weight 52 kDa
Gene ID 27250
NCBI Accession NM_014456, NP_055271
UniProt O15501
Research Area Cancer, Apoptosis/Necrosis, Transcription Factors, Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 469 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Programmed Cell Death 4 (Neoplastic Transformation Inhibitor) (PDCD4) (N-Term) antibody anti-Programmed Cell Death 4 (Neoplastic Transformation Inhibitor) (PDCD4) (N-Term) antibody
Background publications Yang, Matthews, Clair et al.: "Tumorigenesis suppressor Pdcd4 down-regulates mitogen-activated protein kinase kinase kinase kinase 1 expression to suppress colon carcinoma cell invasion." in: Molecular and cellular biology, Vol. 26, Issue 4, pp. 1297-306, 2006 (PubMed).

Hosts (108), (22), (4)
Reactivities (136), (85), (85), (11), (6), (3), (3), (2), (1)
Applications (117), (80), (46), (34), (12), (10), (6), (5), (3), (3), (2)
Conjugates (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (24), (23), (10), (10), (10), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top