beta 2 Defensin antibody (AA 4-41)

Catalog No. ABIN234970

This Mouse Monoclonal antibody specifically detects beta 2 Defensin in ELISA. It exhibits reactivity toward Human.

Quick Overview for beta 2 Defensin antibody (AA 4-41) (ABIN234970)

Target: beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This beta 2 Defensin antibody is un-conjugated

Application: ELISA

Clone: L12-4C-C2

Product Details anti-beta 2 Defensin Antibody

Binding Specificity: AA 4-41

Specificity: Synthetic human beta-Defensin 2 (AA 4-41)

Characteristics: MAb to beta-Defensin-2 (AA 4-41), Monoclonal antibody to Human beta-Defensin-2 (AA 4-41), Cell culture supernatant

Purification: Protein L. Cell culture

Immunogen: Synthetic human beta-Defensin 2 (AA 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)

Isotype: IgG1

Application Details

Application Notes: Suitable for use in ELISA. Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Reconstitute in 10 µL double distilled water.

Buffer: Lyophilized from 50 mM Tris, pH 7.4.

Preservative: Without preservative

Handling Advice: Avoid multiple freeze/thaw cycles.
Centrifuge product if not completely clear after standing at room temperature.
Prepare working dilution only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store lyophilized product at 2-8 °C. After reconstitution, store at -28 °C.

Target Details for beta 2 Defensin

Target: beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Alternative Name: Beta-Defensin-2