HPSE antibody (Middle Region)
-
- Target See all HPSE Antibodies
- HPSE (Heparanase (HPSE))
-
Binding Specificity
- AA 301-331, Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HPSE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Heparanase(HPSE) detection. Tested with WB in Human,Rat.
- Sequence
- NGRTATKEDF LNPDVLDIFI SSVQKVFQVV E
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Heparanase(HPSE) detection. Tested with WB in Human,Rat.
Gene Name: heparanase
Protein Name: Heparanase - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product HPSE Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat, The detection limit for Heparanase 1 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Expression and correlation of matrix metalloproteinase-9 and heparanase in patients with breast cancer." in: Medical oncology (Northwood, London, England), Vol. 31, Issue 7, pp. 26, (2014) (PubMed).
: "Inhibition of choriocarcinoma by Fe3O4-dextran-anti-β-human chorionic gonadotropin nanoparticles containing antisense oligodeoxynucleotide of heparanase." in: International journal of nanomedicine, Vol. 8, pp. 4371-8, (2014) (PubMed).
: "The expression and clinical significance of microRNA-1258 and heparanase in human breast cancer." in: Clinical biochemistry, Vol. 46, Issue 10-11, pp. 926-32, (2013) (PubMed).
: "
-
Expression and correlation of matrix metalloproteinase-9 and heparanase in patients with breast cancer." in: Medical oncology (Northwood, London, England), Vol. 31, Issue 7, pp. 26, (2014) (PubMed).
-
- Target
- HPSE (Heparanase (HPSE))
- Alternative Name
- HPSE (HPSE Products)
- Synonyms
- im:7144134 antibody, hpa antibody, hpa1 antibody, hpr1 antibody, hpse1 antibody, hse1 antibody, HPSE antibody, HPA antibody, HPA1 antibody, HPR1 antibody, HPSE1 antibody, HSE1 antibody, Hpa antibody, Hpr1 antibody, Hep antibody, heparanase antibody, HPSE antibody, hpse antibody, Hpse antibody
- Background
-
Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.
Synonyms: Endo glucoronidase antibody|Endo-glucoronidase antibody|HEP antibody|Heparanase 50 kDa subunit antibody|Heparanase antibody|Heparanase-1 antibody|Heparanase1 antibody|Hpa 1 antibody|HPA antibody|Hpa1 antibody|HPR 1 antibody|HPR1 antibody|HPSE 1 antibody|HPSE antibody|HPSE_HUMAN antibody|HPSE1 antibody|HSE 1 antibody|HSE1 antibody - Gene ID
- 10855
- UniProt
- Q9Y251
- Pathways
- Glycosaminoglycan Metabolic Process
-