KCNA3 antibody (C-Term)
-
- Target See all KCNA3 Antibodies
- KCNA3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3))
-
Binding Specificity
- AA 513-544, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 3(KCNA3) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- EELRKARSNS TLSKSEYMVI EEGGMNHSAF PQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 3(KCNA3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: potassium channel, voltage gated shaker related subfamily A, member 3
Protein Name: Potassium voltage-gated channel subfamily A member 3 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human KCNA3 (513-544aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product KCNA3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- KCNA3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3))
- Alternative Name
- KCNA3 (KCNA3 Products)
- Synonyms
- Kv1.3-glyb antibody, kv1.3 antibody, Kv1.3B antibody, kcna3b-a antibody, HGK5 antibody, HLK3 antibody, HPCN3 antibody, HUKIII antibody, KV1.3 antibody, MK3 antibody, PCN3 antibody, Kca1-3 antibody, Kv1.3 antibody, Mk-3 antibody, cKv1.1 antibody, potassium voltage-gated channel subfamily A member 3 antibody, potassium channel, voltage gated shaker related subfamily A, member 3 S homeolog antibody, potassium voltage-gated channel, shaker-related subfamily, member 3 antibody, KCNA3 antibody, kcna3.S antibody, Kcna3 antibody
- Background
-
Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.
Synonyms: HGK 5 antibody|HGK5 antibody|HLK 3 antibody|HLK3 antibody|HPCN 3 antibody|HPCN3 antibody|HuKIII antibody|KCNA 3 antibody|Kcna3 antibody|KCNA3_HUMAN antibody|KV1.3 antibody|MK 3 antibody|MK3 antibody|OTTHUMP00000032397 antibody|PCN 3 antibody|PCN3 antibody| Potassium channel 3 antibody|Potassium voltage gated channel shaker related subfamily member 3 antibody|Potassium voltage gated channel subfamily A member 3 antibody|Potassium voltage-gated channel subfamily A member 3 antibody|Type n potassium channel antibody| Voltage gated potassium channel protein Kv1.3 antibody|Voltage gated potassium channel subunit Kv1.3 antibody|Voltage-gated K(+) channel HuKIII antibody|Voltage-gated potassium channel subunit Kv1.3 antibody - Gene ID
- 3738
- UniProt
- P22001
-