SPARC antibody (C-Term)
-
- Target See all SPARC Antibodies
- SPARC (Secreted Protein, Acidic, Cysteine-Rich (Osteonectin) (SPARC))
-
Binding Specificity
- AA 268-303, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPARC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for SPARC(SPARC) detection. Tested with WB in Human.
- Sequence
- RFFETCDLDN DKYIALDEWA GCFGIKQKDI DKDLVI
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for SPARC(SPARC) detection. Tested with WB in Human.
Gene Name: secreted protein, acidic, cysteine-rich (osteonectin)
Protein Name: SPARC - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human SPARC (268-303aa RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI), different from the related mouse and rat sequences by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SPARC Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SPARC (Secreted Protein, Acidic, Cysteine-Rich (Osteonectin) (SPARC))
- Alternative Name
- SPARC (SPARC Products)
- Synonyms
- ON antibody, AA517111 antibody, BM-40 antibody, hm:zeh0062 antibody, SPARC antibody, sparc antibody, secreted protein acidic and cysteine rich antibody, secreted acidic cysteine rich glycoprotein antibody, secreted protein, acidic, cysteine-rich (osteonectin) antibody, secreted protein, acidic, cysteine-rich (osteonectin) L homeolog antibody, secreted protein, acidic, cysteine-rich (osteonectin) S homeolog antibody, SPARC antibody, Sparc antibody, sparc antibody, sparc.L antibody, sparc.S antibody
- Background
-
SPARC, secreted protein acidic and rich in cysteine , also known as Osteonectin is a protein that in humans is encoded by the SPARC gene. The human SPARC gene is 26.5 kb long, and contains 10 exons and 9 introns and is located on chromosome 5q31-q33. SPARC is a glycoprotein of 40 kD. SPARC is an acidic, cysteine-rich glycoprotein consisting of a single polypeptide chain that can be broken into 4 domains: 1) an Ca++ binding domains near the glutamic acidic-rich region at the amino terminus (domain I), 2) a cysteine- rich (domain II), 3) a hydrophilic region (domain III) and 4) an EF hand motif at the carboxy terminus region (domain IV). Osteonectin is a glycoprotein in the bone that binds sodium. It is secreted by osteoblasts during bone formation, initiating mineralization and promoting mineral crystal formation. Osteonectin also shows affinity for collagen in addition to bone mineral calcium. A correlation between osteonectin over expression and ampullary cancers and chronic pancreatitis has been found.
Synonyms: AA517111 antibody|Basement membrane protein 40 antibody|Basement-membrane protein 40 antibody|BM 40 antibody|BM-40 antibody|BM40 antibody|Cysteine rich protein antibody| hm:zeh0062 antibody|MGC128090 antibody|ON antibody|Osteonectin antibody|Secreted acidic cystein rich glycoprotein antibody|Secreted protein acidic and rich in cysteine antibody| Secreted protein acidic cysteine rich (osteonectin) antibody|Secreted protein acidic cysteine rich antibody|SPARC antibody|SPRC antibody|SPRC_HUMAN antibody - Gene ID
- 6678
- UniProt
- P09486
- Pathways
- Autophagy
-