RAB14 antibody (C-Term)
-
- Target See all RAB14 Antibodies
- RAB14 (RAB14, Member RAS Oncogene Family (RAB14))
-
Binding Specificity
- AA 124-153, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAB14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Ras-related protein Rab-14(RAB14) detection. Tested with WB in Human,Rat.
- Sequence
- NKADLEAQRD VTYEEAKQFA EENGLLFLEA
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Ras-related protein Rab-14(RAB14) detection. Tested with WB in Human,Rat.
Gene Name: RAB14, member RAS oncogene family
Protein Name: Ras-related protein Rab-14 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human RAB14 (124-153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product RAB14 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- RAB14 (RAB14, Member RAS Oncogene Family (RAB14))
- Alternative Name
- RAB14 (RAB14 Products)
- Synonyms
- FBP antibody, RAB-14 antibody, 0610030G24Rik antibody, 2810475J17Rik antibody, A830021G03Rik antibody, AI314285 antibody, AI649155 antibody, D030017L14Rik antibody, cb731 antibody, fc26g11 antibody, fj47f07 antibody, fj68a01 antibody, wu:fc26g11 antibody, wu:fj47f07 antibody, wu:fj68a01 antibody, fbp antibody, rab-14 antibody, MGC79630 antibody, MGC80680 antibody, RAB14 antibody, RAB14, member RAS oncogene family antibody, RAB14, member RAS oncogene family S homeolog antibody, RAB14 antibody, Rab14 antibody, rab14 antibody, rab14.S antibody
- Background
-
Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene. It is mapped to 9q33.2 based on an alignment of the RAB14 sequence with the genomic sequence. RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes.
Synonyms: bA165P4.3 antibody|F protein binding protein 1 antibody|FBP antibody|GTPase Rab14 antibody|RAB 14 antibody|RAB14 antibody|RAB14 member RAS oncogene family antibody|RAB14_HUMAN antibody|Ras related protein Rab 14 antibody|Ras-related protein Rab-14 antibody|RP11 165P4.4 antibody|Small GTP binding protein RAB14 antibody - Gene ID
- 51552
- UniProt
- P61106
- Pathways
- Asymmetric Protein Localization, SARS-CoV-2 Protein Interactome
-