LGALS8 antibody (C-Term)
-
- Target See all LGALS8 Antibodies
- LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))
-
Binding Specificity
- AA 286-317, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LGALS8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human,Rat.
- Sequence
- HSLEYKHRFK ELSSIDTLEI NGDIHLLEVR SW
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human,Rat.
Gene Name: lectin, galactoside-binding, soluble, 8
Protein Name: Galectin-8 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product LGALS8 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))
- Alternative Name
- LGALS8 (LGALS8 Products)
- Synonyms
- LGALS8 antibody, 1200015E08Rik antibody, AI326142 antibody, D13Ertd524e antibody, Lgals-8 antibody, galectin-8 antibody, Gal-8 antibody, PCTA-1 antibody, PCTA1 antibody, Po66-CBP antibody, xgalectin-VIIIa antibody, galectin 8 antibody, lectin, galactose binding, soluble 8 antibody, lectin, galactoside binding soluble 8 S homeolog antibody, LGALS8 antibody, Lgals8 antibody, lgals8.S antibody
- Background
-
Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: Gal 8 antibody|Gal-8 antibody|Gal8 antibody|Galectin-8 antibody|galectin-8g antibody|Lectin galactoside binding soluble 8 antibody| LEG8_HUMAN antibody|LGAL S8 antibody|Lgals8 antibody|PCTA 1 antibody|PCTA-1 antibody|PCTA1 antibody|Po66 carbohydrate binding protein antibody|Po66 carbohydrate-binding protein antibody|Po66 CBP antibody|Po66-CBP antibody|Prostate carcinoma tumor antigen 1 antibody - Gene ID
- 3964
- UniProt
- O00214
-