BMP4 antibody (C-Term)
-
- Target See all BMP4 Antibodies
- BMP4 (Bone Morphogenetic Protein 4 (BMP4))
-
Binding Specificity
- AA 293-324, C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BMP4 antibody is un-conjugated
-
Application
- Western Blotting (WB), ELISA
- Purpose
- Rabbit IgG polyclonal antibody for Bone morphogenetic protein 4(BMP4) detection. Tested with WB, ELISA in Human,Mouse.
- Sequence
- SPKHHSQRAR KKNKNCRRHS LYVDFSDVGW ND
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Bone morphogenetic protein 4(BMP4) detection. Tested with WB, ELISA in Human,Mouse.
Gene Name: bone morphogenetic protein 4
Protein Name: Bone morphogenetic protein 4 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND), different from the related mouse and rat sequences by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product BMP4 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).
: "Expansive effects of aorta-gonad-mesonephros-derived stromal cells on hematopoietic stem cells from embryonic stem cells." in: Chinese medical journal, Vol. 118, Issue 23, pp. 1979-86, (2005) (PubMed).
: "
-
Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).
-
- Target
- BMP4 (Bone Morphogenetic Protein 4 (BMP4))
- Alternative Name
- BMP4 (BMP4 Products)
- Synonyms
- BMP2B antibody, BMP2B1 antibody, MCOPS6 antibody, OFC11 antibody, ZYME antibody, Bmp-4 antibody, Bmp2b antibody, Bmp2b-1 antibody, Bmp2b1 antibody, BOMPR4A antibody, bmp-4 antibody, zbmp-4 antibody, zgc:100779 antibody, BMP-4 antibody, XBMP-4 antibody, bmp2b antibody, bmp2b1 antibody, bmp4 antibody, ofc11 antibody, xbmp4 antibody, zyme antibody, BMP4 antibody, bone morphogenetic protein 4 antibody, bone morphogenetic protein 4 L homeolog antibody, bone morphogenetic protein 4 S homeolog antibody, BMP4 antibody, Bmp4 antibody, bmp4 antibody, bmp4.L antibody, bmp4.S antibody
- Background
-
Bone morphogenetic protein 4 is a protein that in humans is encoded by BMP4 gene. It is found on chromosome 14q22-q23. The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Synonyms: BMP 2B antibody|BMP 4 antibody|BMP-2B antibody|BMP-4 antibody|BMP2B antibody|BMP2B1 antibody|BMP4 antibody|BMP4_HUMAN antibody|Bone morphogenetic protein 2B antibody|Bone morphogenetic protein 4 antibody|DVR4 antibody|MCOPS6 antibody|OFC11 antibody|ZYME antibody - Gene ID
- 652
- UniProt
- P12644
- Pathways
- Steroid Hormone Mediated Signaling Pathway, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development
-