ADRBK2 antibody (C-Term)
-
- Target See all ADRBK2 Antibodies
- ADRBK2 (Adrenergic, Beta, Receptor Kinase 2 (ADRBK2))
-
Binding Specificity
- AA 635-669, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADRBK2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Beta-adrenergic receptor kinase 2(ADRBK2) detection. Tested with WB in Human.
- Sequence
- ESDPEFVQWK KELNETFKEA QRLLRRAPKF LNKPR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Beta-adrenergic receptor kinase 2(ADRBK2) detection. Tested with WB in Human.
Gene Name: adrenergic, beta, receptor kinase 2
Protein Name: Beta-adrenergic receptor kinase 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR), different from the related mouse and rat sequences by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ADRBK2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ADRBK2 (Adrenergic, Beta, Receptor Kinase 2 (ADRBK2))
- Alternative Name
- ADRBK2 (ADRBK2 Products)
- Synonyms
- bark2 antibody, grk3 antibody, 4833444A01Rik antibody, AI851927 antibody, AW551196 antibody, Adrbk-2 antibody, Bark-2 antibody, GRK3 antibody, BARK2 antibody, Grk3 antibody, si:dz221d18.1 antibody, G protein-coupled receptor kinase 3 antibody, GRK3 antibody, grk3 antibody, Grk3 antibody
- Background
-
Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85 % amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95 % similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.
Synonyms: ADRBK2 antibody|Adrenergic, beta, receptor kinase 2 antibody|ARBK2_HUMAN antibody|BARK2 antibody|Beta adrenergic receptor kinase 2 antibody|Beta ARK 2 antibody|Beta-adrenergic receptor kinase 2 antibody|Beta-ARK-2 antibody|EC 2.7.11.15 antibody|G protein coupled receptor kinase 3 antibody|G-protein-coupled receptor kinase 3 antibody|GRK3 antibody - Gene ID
- 157
- UniProt
- P35626
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling
-