Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

HSPA9 antibody (C-Term)

HSPA9 Reactivity: Human, Rat, Mouse WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043853
  • Target See all HSPA9 Antibodies
    HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))
    Binding Specificity
    • 15
    • 8
    • 7
    • 7
    • 7
    • 6
    • 6
    • 5
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 646-679, C-Term
    Reactivity
    • 78
    • 41
    • 26
    • 7
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Human, Rat, Mouse
    Host
    • 72
    • 7
    Rabbit
    Clonality
    • 73
    • 6
    Polyclonal
    Conjugate
    • 39
    • 6
    • 6
    • 4
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This HSPA9 antibody is un-conjugated
    Application
    • 60
    • 28
    • 24
    • 18
    • 13
    • 13
    • 8
    • 7
    • 6
    • 5
    • 4
    • 4
    • 2
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    KLFEMAYKKM ASEREGSGSS GTGEQKEDQK EEKQ
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: heat shock 70 kDa protein 9 (mortalin)
    Protein Name: Stress-70 protein, mitochondrial
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product HSPA9 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Target
    HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))
    Alternative Name
    HSPA9 (HSPA9 Products)
    Synonyms
    APG-2 antibody, HS24/P52 antibody, HSPH2 antibody, RY antibody, hsp70 antibody, hsp70RY antibody, CSA antibody, GRP-75 antibody, GRP75 antibody, HSPA9B antibody, MOT antibody, MOT2 antibody, MTHSP75 antibody, PBP74 antibody, Hspa9a antibody, csa antibody, grp-75 antibody, grp75 antibody, hspa9 antibody, hspa9b antibody, mortalin antibody, mot antibody, mot2 antibody, pbp74 antibody, mot-2 antibody, mthsp75 antibody, 74kDa antibody, Csa antibody, Grp75 antibody, Hsc74 antibody, Hsp74 antibody, Hsp74a antibody, Mortalin antibody, Mot-2 antibody, Mot2 antibody, Mthsp70 antibody, Pbp74 antibody, cb740 antibody, crs antibody, wu:fc14d08 antibody, wu:fc27c10 antibody, wu:fc38a06 antibody, heat shock protein family A (Hsp70) member 4 antibody, heat shock protein family A (Hsp70) member 9 antibody, heat shock protein family A member 9 antibody, heat shock protein family A (Hsp70) member 9 S homeolog antibody, stress-70 protein, mitochondrial antibody, heat shock protein 9 antibody, heat shock protein Hsp9 antibody, HSPA4 antibody, HSPA9 antibody, Hspa9 antibody, hspa9.S antibody, hspa9 antibody, LOC577721 antibody, hsp9 antibody
    Background
    HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

    Synonyms: 75 kDa glucose regulated protein antibody|75 kDa glucose-regulated protein antibody|CSA antibody|Glucose Regulated Protein antibody| Grp 75 antibody|GRP-75 antibody|GRP75 antibody| GRP75_HUMAN antibody|Heat shock 70 kDa protein 9 antibody|Heat shock 70kD protein 9 antibody|heat shock 70 kDa protein 9 antibody|Heat shock 70 kDa protein 9B antibody|Heat shock protein 74 kDa A antibody|Heat shock protein A antibody|Heat shock protein cognate 74 antibody|Hsc74 antibody|Hsp74 antibody|Hsp74a antibody|HSPA9 antibody|Hspa9a antibody|HSPA9B antibody|MGC4500 antibody|mitochondrial antibody|Mortalin 2 antibody|Mortalin antibody|Mortalin perinuclear antibody| Mortalin2 antibody|MOT 2 antibody|MOT antibody|MOT2 antibody|Mthsp70 antibody|p66 mortalin antibody|P66 MOT antibody|PBP74 antibody| Peptide binding protein 74 antibody|Peptide-binding protein 74 antibody|Stress 70 protein mitochondrial antibody|Stress 70 protein mitochondrial precursor antibody|Stress-70 protein antibody
    Gene ID
    3313
    UniProt
    P38646
You are here:
Support