IGFBP2 antibody (C-Term)
-
- Target See all IGFBP2 Antibodies
- IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))
-
Binding Specificity
- AA 228-257, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IGFBP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 2(IGFBP2) detection. Tested with WB in Human,Rat.
- Sequence
- QQELDQVLER ISTMRLPDER GPLEHLYSLH
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 2(IGFBP2) detection. Tested with WB in Human,Rat.
Gene Name: insulin-like growth factor binding protein 2, 36 kDa
Protein Name: Insulin-like growth factor-binding protein 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP2 (228-257aa QQELDQVLERISTMRLPDERGPLEHLYSLH), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product IGFBP2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))
- Alternative Name
- IGFBP2 (IGFBP2 Products)
- Synonyms
- IBP2 antibody, IGF-BP53 antibody, AI255832 antibody, IBP-2 antibody, Igfbp-2 antibody, mIGFBP-2 antibody, IGFBP-2 antibody, ILGFBPA antibody, pIGFBP-2 antibody, igfbp2 antibody, MGC65741 antibody, MGC76823 antibody, MGC174445 antibody, IGFBP2 antibody, ibp2 antibody, igf-bp53 antibody, igfbp2a antibody, si:ch211-2k18.3 antibody, insulin like growth factor binding protein 2 antibody, insulin-like growth factor binding protein 2 antibody, insulin-like growth factor binding protein 2a antibody, insulin-like growth factor binding protein 2b antibody, IGFBP2 antibody, Igfbp2 antibody, igfbp2a antibody, igfbp2 antibody, igfbp2b antibody
- Background
-
The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-translational modifications of IGFBPs, including glycosylation, phosphorylation and proteolysis, have been shown to modify the affinities of the binding proteins to IGF. Human IGFBP-2 cDNA encodes a 328 amino acid (aa) residue precursor protein with a putative 39 aa residue signal peptide that is processed to generate the 289 aa residue mature protein. IGFBP-2 contains an integrin receptor recognition sequence (RGD sequence) but lacks potential N-linked glycosylation sites. During development, IGFBP-2 is expressed in a number of tissues. The highest expression level is found in the central nervous system. In adults, high expression levels are also detected in the central nervous system and in a number of reproductive tissues. IGFBP-2 binds preferentially to IGF II, exhibiting a 2-10 fold higher affinity for IGF II than for IGF I.
Synonyms: BP 2 antibody|BP2 antibody|IBP 2 antibody|IBP-2 antibody|IBP2 antibody|IBP2_HUMAN antibody|IGF binding protein 2 antibody|IGF BP53 antibody|IGF-binding protein 2 antibody|IGFBP 2 antibody|IGFBP-2 antibody|IGFBP2 antibody|IGFBP53 antibody|Insulin like growth factor binding protein 2 36 kDa antibody|Insulin like growth factor binding protein 2 antibody|Insulin like growth factor-binding protein 2 precursor antibody|Insulin-like growth factor-binding protein 2 antibody - Gene ID
- 3485
- UniProt
- P18065
- Pathways
- Myometrial Relaxation and Contraction, Growth Factor Binding, Activated T Cell Proliferation
-