Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

MMP8 antibody (N-Term)

MMP8 Reactivity: Mouse, Rat WB, ELISA, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043883
  • Target See all MMP8 Antibodies
    MMP8 (Matrix Metallopeptidase 8 (Neutrophil Collagenase) (MMP8))
    Binding Specificity
    • 16
    • 9
    • 8
    • 6
    • 5
    • 5
    • 5
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 120-157, N-Term
    Reactivity
    • 61
    • 33
    • 13
    • 1
    • 1
    Mouse, Rat
    Host
    • 75
    • 7
    Rabbit
    Clonality
    • 76
    • 6
    Polyclonal
    Conjugate
    • 33
    • 8
    • 8
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    This MMP8 antibody is un-conjugated
    Application
    • 68
    • 33
    • 24
    • 11
    • 8
    • 8
    • 7
    • 5
    • 1
    • 1
    • 1
    Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Mouse,Rat.
    Sequence
    HTPQLSRAEV KTAIEKAFHV WSVASPLTFT EILQGEAD
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Mouse,Rat.
    Gene Name: matrix metallopeptidase 8 (neutrophil collagenase)
    Protein Name: Neutrophil collagenase
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product MMP8 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse

    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Liu, Li, Liang, Li, Jiang, Chu, Yang: "Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).

    Gao, Tang, He, Liu, Mao, Ji, Lin, Wu: "Glycyrrhizic acid alleviates bleomycin-induced pulmonary fibrosis in rats." in: Frontiers in pharmacology, Vol. 6, pp. 215, (2015) (PubMed).

    Zhong, Wang, Jian: "Expression of matrix metalloproteinases-8 and -9 and their tissue inhibitor in the condyles of diabetic rats with mandibular advancement." in: Experimental and therapeutic medicine, Vol. 8, Issue 5, pp. 1357-1364, (2014) (PubMed).

  • Target
    MMP8 (Matrix Metallopeptidase 8 (Neutrophil Collagenase) (MMP8))
    Alternative Name
    MMP8 (MMP8 Products)
    Synonyms
    MMP8 antibody, BB138268 antibody, CLG1 antibody, HNC antibody, MMP-8 antibody, PMNL-CL antibody, matrix metallopeptidase 8 antibody, neutrophil collagenase antibody, MMP8 antibody, Mmp8 antibody, LOC100339790 antibody
    Background
    MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58 % homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57 % identity with the deduced protein sequence for fibroblast collagenase with 72 % chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.

    Synonyms: CLG 1 antibody|CLG1 antibody|Collagenase 1 antibody|Collagenase 1 neutrophil antibody|HNC antibody|Matrix metallopeptidase 8 (neutrophil collagenase) antibody|Matrix metalloprotease 8 antibody|Matrix metalloproteinase-8 antibody|MMP 8 antibody|MMP-8 antibody| Mmp8 antibody| MMP8_HUMAN antibody|Neutrophil collagenase antibody|PMNL CL antibody|PMNL collagenase antibody|PMNL-CL antibody|PMNLCL antibody
    Gene ID
    17394
    UniProt
    O70138
You are here:
Support