TAP1 antibody (Middle Region)

Catalog No. ABIN3043943

Product Details anti-TAP1 Antibody

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Binding Specificity: AA 438-471, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TAP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Antigen peptide transporter 1(TAP1) detection. Tested with WB, IHC-P in Human.

Sequence: RSFANEEGEA QKFREKLQEI KTLNQKEAVA YAVN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Antigen peptide transporter 1(TAP1) detection. Tested with WB, IHC-P in Human.
Gene Name: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Protein Name: Antigen peptide transporter 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for TAP1

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Alternative Name: TAP1 (TAP1 Products)

Synonyms: ABC17 antibody, ABCB2 antibody, APT1 antibody, D6S114E antibody, PSF-1 antibody, PSF1 antibody, RING4 antibody, TAP1*0102N antibody, TAP1N antibody, abc17 antibody, abcb2 antibody, apt1 antibody, psf1 antibody, ring4 antibody, tap1a antibody, tap1n antibody, Abcb2 antibody, Ham-1 antibody, Ham1 antibody, MTP1 antibody, TAP antibody, Tap-1 antibody, Y3 antibody, Cim antibody, transporter 1, ATP binding cassette subfamily B member antibody, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) L homeolog antibody, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) antibody, TAP1 antibody, tap1.L antibody, Tap1 antibody

Background: Transporter associated with Antigen Processing 1 is a protein that in humans is encoded by the TAP1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene.

Synonyms: ABC 17 antibody|ABC transporter MHC 1 antibody|ABC17 antibody|ABCB 2 antibody|ABCB2 antibody|Antigen peptide transporter 1 antibody| APT 1 antibody|APT1 antibody|ATP binding cassette sub family B (MDR/TAP) member 2 antibody|ATP binding cassette sub family B member 2 antibody|ATP binding cassette transporter antibody|ATP-binding cassette sub-family B member 2 antibody|D6S114E antibody|FLJ26666 antibody|FLJ41500 antibody|Peptide supply factor 1 antibody|Peptide transporter involved in antigen processing 1 antibody|Peptide transporter PSF 1 antibody|Peptide transporter PSF1 antibody|Peptide transporter TAP 1 antibody|Peptide transporter TAP1 antibody|PSF 1 antibody|PSF-1 antibody|PSF1 antibody|Really interesting new gene 4 protein antibody|RING 4 antibody|RING4 antibody|TAP 1 antibody| TAP1 antibody|TAP1*0102N antibody|TAP1_HUMAN antibody|TAP1N antibody|Transporter 1 ATP binding cassette sub family B (MDR/TAP) antibody|Transporter 1 ATP binding cassette sub family B antibody|Transporter associated with antigen processing antibody|Transporter ATP binding cassette major histocompatibility complex 1 antibody|Y3 antibody

Gene ID: 6890

UniProt: Q03518

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process