Did you know that you can buy products from over 140 different suppliers from us?

protein ariadne-2 homolog (ARIH2) (N-Term) antibody

Details for Product No. ABIN309734
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARI2, TRIAD1, AI843547, UIP48
Epitope
N-Term
(9), (7), (5), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(45), (19), (18), (13), (13), (13), (2), (1)
Host
Rabbit
(35), (6), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(30), (16), (10), (10), (5), (3), (3), (2), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309734
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ARIH2
Sequence EDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAF DPEEYQFTCL
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against ARIH2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name ARIH2
Background ARIH2 might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates.
Molecular Weight 58 kDa
Gene ID 10425
NCBI Accession NM_006321, NP_006312
UniProt O95376
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Chromatin Binding Proteins, Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 493 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-protein ariadne-2 homolog (ARIH2) (N-Term) antibody WB Suggested Anti-ARIH2 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
anti-protein ariadne-2 homolog (ARIH2) (N-Term) antibody (2) anti-protein ariadne-2 homolog (ARIH2) (N-Term) antibody (Image 2)
anti-protein ariadne-2 homolog (ARIH2) (N-Term) antibody (3) Host: Rabbit
Target Name: ARIH2
Sample Tissue: Jurkat
Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1.25 µg/mL Peptide Concentration: 1.0 µg/mL Lysate Quantity: 241 µg/laneGel Concentration: 12 %There is BioGPS gene expression data showing that ARIH2 is expressed in Jurkat
Background publications Marteijn, van Emst, Erpelinck-Verschueren et al.: "The E3 ubiquitin-protein ligase Triad1 inhibits clonogenic growth of primary myeloid progenitor cells." in: Blood, Vol. 106, Issue 13, pp. 4114-23, 2005 (PubMed).

Validation Images
back to top