Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309734

protein ariadne-2 homolog (ARIH2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARI2, TRIAD1, UIP48, AI843547
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN309734
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ARIH2 antibody: synthetic peptide directed towards the N terminal of human ARIH2
Sequence EDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAF DPEEYQFTCL
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Chicken : 92%, African clawed frog : 85%
Characteristics This is a rabbit polyclonal antibody against ARIH2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name ARIH2
Background ARIH2 might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates.
Molecular Weight 58kDa
Gene ID 10425
NCBI Accession NP_006312, NM_006321
UniProt O95376
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Chromatin Binding Proteins, Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ARIH2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Marteijn, van Emst, Erpelinck-Verschueren et al.: "The E3 ubiquitin-protein ligase Triad1 inhibits clonogenic growth of primary myeloid progenitor cells." in: Blood, Vol. 106, Issue 13, pp. 4114-23, 2005 (PubMed).

Alternatives for antigen "protein ariadne-2 homolog (ARIH2)", type "Antibodies"
Hosts (28), (7), (5)
Reactivities (39), (17), (17), (13), (13), (13), (2), (1)
Applications (25), (13), (10), (6), (5), (3), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (5), (2), (2), (2), (1), (1)
Beacon