Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309741

Zinc Finger Protein 261 (ZMYM3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DXS6673E, MYM, XFIM, ZNF198L2, ZNF261, 9030216B10Rik, AW122925, DXS6673El, Zfp261, si:ch211-173p18.2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309741
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZMYM3 antibody: synthetic peptide directed towards the N terminal of human ZMYM3
Sequence MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTA PTRGWAPPGP
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against ZMYM3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZMYM3
Background The function remains unknown. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Molecular Weight 152kDa
Gene ID 9203
NCBI Accession NP_005087, NM_005096
UniProt Q14202
Research Area Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZMYM3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 261 (ZMYM3)", type "Antibodies"
Hosts (19)
Reactivities (19), (8), (1), (1), (1)
Applications (18), (8), (3), (1)
Epitopes (6), (6), (1)
Beacon