Zinc Finger Protein 261 (ZMYM3) antibody

Antigen: Zinc Finger Protein 261 (ZMYM3)

Synonyms: MYM, XFIM, ZNF261, DXS6673E, KIAA0385, ZNF198L2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN309741

Additional Information

Alternative name: ZMYM3

Gene ID: ZMYM3

Immunogen: The immunogen for anti-ZMYM3 antibody: synthetic peptide directed towards the N terminal of human ZMYM3

Sequence: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTA PTRGWAPPGP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZMYM3 antibody concentration is 1 mg/ml.

Description: The function remains unknown. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Characteristics: Antigen Size: 1370 amino acids

Molecular Weight: 152kDa

Application Details

Application Notes: WB Suggested Anti-ZMYM3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZMYM3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).