Kelch-Like ECH-Associated Protein 1 (KEAP1) antibody

Antigen: Kelch-Like ECH-Associated Protein 1 (KEAP1)

Synonyms: INrf2, KLHL19, MGC1114, MGC4407, MGC9454, KIAA0132, MGC10630, MGC20887, INRF2, mKIAA0132, Inrf2, keap1, fb36f11, MGC136521, wu:fb36f11, KEAP1, MGC79519, klhl19, FLJ12949, DKFZp469D1319

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Zebrafish, Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN309756

Additional Information

Alternative name: KEAP1

Gene ID: KEAP1

UniProt: Q14145

Immunogen: The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1

Sequence: TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVE CYDPDTDTWS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-KEAP1 antibody concentration is 1 mg/ml.

Description: KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.

Characteristics: Antigen Size: 624 amino acids

Molecular Weight: 70kDa

Application Details

Application Notes: WB Suggested Anti-KEAP1 Antibody Titration: 1.0ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-KEAP1 Antibody Titration: 1.0ug/ml
Positive Control: HepG2 cell lysate

anti-Kelch-Like ECH-Associated Protein 1 (KEAP1) antibody (Image 2)

Publications

Product: Padmanabhan, Tong, Ohta et al.: "Structural basis for defects of Keap1 activity provoked by its point mutations in lung cancer." in: Molecular cell, Vol. 21, Issue 5, pp. 689-700, 2006 (PubMed).