Did you know that you can buy products from over 140 different suppliers from us?

Annexin A8-Like 2 (ANXA8L2) (N-Term) antibody

Details for Product No. ABIN309827
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANXA8, bA145E20.2, ANXA8L1, ANXA8L2
Epitope
N-Term
(1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
(10), (5), (5), (2), (2), (2), (2), (1), (1)
Host
Rabbit
(13)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (4), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309827
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ANXA8L2
Sequence PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFK AQFGKDLTET
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ANXA8L2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ANXA8L2
Background ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. ANXA8L2 may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of ANXA8L2 has been associated with acute myelocytic leukemia.This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
Molecular Weight 37 kDa
Gene ID 244
NCBI Accession NM_001630, NP_001621
UniProt Q5VT79
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 327 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Annexin A8-Like 2 (ANXA8L2) (N-Term) antibody WB Suggested Anti-ANXA8L2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Background publications Karanjawala, Illei, Ashfaq et al.: "New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8." in: The American journal of surgical pathology, Vol. 32, Issue 2, pp. 188-96, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309827
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top