Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309881

Zinc Finger Protein 264 (ZNF264) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF460, ZNF264
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309881
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF264 antibody: synthetic peptide directed towards the C terminal of human ZNF264
Sequence SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPY QRETPQVSSL
Predicted Reactivity Human : 100%, Horse : 85%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against ZNF264. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF264
Background ZNF264 may be involved in transcriptional regulation.
Molecular Weight 71kDa
Gene ID 9422
NCBI Accession NP_003408, NM_003417
UniProt O43296
Research Area Chromatin and Nuclear Signaling, Transcription Factors, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF264 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 264 (ZNF264)", type "Antibodies"
Hosts (8)
Reactivities (7), (1), (1), (1), (1)
Applications (7), (2), (1), (1)
Epitopes (2), (1), (1)
Beacon