Ets Variant 5 (ETV5) (N-Term) antibody

Details for Product No. ABIN309891
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ERM, 1110005E01Rik, 8430401F14Rik, etv5, fj87h10, id:ibd5133, wu:fj87h10, zgc:55647
Epitope
N-Term
(10), (3), (3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(50), (18), (18), (14), (14), (12), (1), (1)
Host
Rabbit
(29), (21)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(38), (19), (10), (5), (4), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN309891
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ETV5
Sequence PFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQD LSQLQEAWLA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against ETV5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ETV5
Background ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer.
Molecular Weight 58 kDa
Gene ID 2119
NCBI Accession NM_004454, NP_004445
UniProt P41161
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 510 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Helgeson, Tomlins, Shah et al.: "Characterization of TMPRSS2:ETV5 and SLC45A3:ETV5 gene fusions in prostate cancer." in: Cancer research, Vol. 68, Issue 1, pp. 73-80, 2008 (PubMed).

Hosts (29), (21)
Reactivities (50), (18), (18), (14), (14), (12), (1), (1)
Applications (38), (19), (10), (5), (4), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (3), (3), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top