Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2) antibody

Antigen: Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310067

Additional Information

Alternative name: FARS2

Gene ID: FARS2

UniProt: O95363

Immunogen: The immunogen for anti-FARS2 antibody: synthetic peptide directed towards the N terminal of human FARS2

Sequence: VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIK ERVKEHFYKQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-FARS2 antibody concentration is 1 mg/ml.

Description: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm.Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS1 encodes a mitochondrially-located phenylalanine-tRNA synthetase (PheRS) which consists of a single polypeptide chain unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and the eukaryotic cytoplasm.

Characteristics: Antigen Size: 451 amino acids

Molecular Weight: 50kDa

Application Details

Application Notes: WB Suggested Anti-FARS2 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA, Metabolism, Amino Acids

Restrictions: For Research Use only

Images

WB Suggested Anti-FARS2 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

anti-Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2) antibody (Image 2)

Publications

Zhang, Walker, Tamplin et al.: "Zfp206 regulates ES cell gene expression and differentiation." in: Nucleic acids research, Vol. 34, Issue 17, pp. 4780-90, 2006 (PubMed).

Product: Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).