FARS2 antibody (N-Term)

Catalog No. ABIN629969

Product Details anti-FARS2 Antibody

Target: FARS2 (Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FARS2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: FARS2 antibody was raised against the N terminal of FARS2

Purification: Purified

Immunogen: FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FARS2 Blocking Peptide, catalog no. 33R-9501, is also available for use as a blocking control in assays to test for specificity of this FARS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FARS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FARS2

Target: FARS2 (Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2))

Alternative Name: FARS2 (FARS2 Products)

Synonyms: 2810431B21Rik antibody, 6720478K01Rik antibody, Fars1 antibody, COXPD14 antibody, FARS1 antibody, HSPC320 antibody, PheRS antibody, dJ520B18.2 antibody, phenylalanine-tRNA synthetase 2 (mitochondrial) antibody, phenylalanyl-tRNA synthetase 2, mitochondrial antibody, Fars2 antibody, FARS2 antibody

Background: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm.

Molecular Weight: 50 kDa (MW of target protein)