TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1) antibody

Antigen: TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1)

Synonyms: TIA-1, mTIA-1, AI256674, 2310050N03Rik, tia1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310093

Additional Information

Alternative name: TIA1

Gene ID: TIA1

UniProt: P31483-2

Immunogen: The immunogen for anti-TIA1 antibody: synthetic peptide directed towards the C terminal of human TIA1

Sequence: QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPS GYRVAGYETQ

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TIA1 antibody concentration is 1 mg/ml.

Description: TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing.The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms of this gene product has been described in the literature.

Characteristics: Antigen Size: 375 amino acids

Molecular Weight: 42kDa

Application Details

Application Notes: WB Suggested Anti-TIA1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Thymus.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA, Adaptive Immunity, Apoptosis/Necrosis

Restrictions: For Research Use only

Images

WB Suggested Anti-TIA1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Thymus

Publications

Product: López de Silanes, Galbán, Martindale et al.: "Identification and functional outcome of mRNAs associated with RNA-binding protein TIA-1." in: Molecular and cellular biology, Vol. 25, Issue 21, pp. 9520-31, 2005 (PubMed).