Did you know that you can buy products from over 140 different suppliers from us?

Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6) (Middle Region) antibody

Details for Product No. ABIN310166
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CD66c, CEAL, NCA
Epitope
Middle Region
(7), (2), (1), (1), (1), (1), (1)
Reactivity
Human
(34)
Host
Rabbit
(31), (4), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(25), (15), (10), (6), (2), (2), (2), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310166
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CEACAM6
Sequence EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENL NLSCHAASNP
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against CEACAM6. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name CEACAM6
Background Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.
Molecular Weight 38 kDa
Gene ID 4680
NCBI Accession NM_002483, NP_002474
UniProt P40199
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 344 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6) (Middle Region) antibody WB Suggested Anti-CEACAM6 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6) (Middle Region) antibody (2) anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6) (Middle Region) antibody (Image 2)
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6) (Middle Region) antibody (3) Host: Rabbit
Target Name: CEACAM6
Sample Tissue: Jurkat
Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1.25 µg/mL Peptide Concentration: 1.0 µg/mL Lysate Quantity: 241 µg/laneGel Concentration: 12 %
anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (Non-Specific Cross Reacting Antigen) (CEACAM6) (Middle Region) antibody (4) WB Suggested Anti-CEACAM6
Antibody Titration: 1.25 µg/mL
Positive Control: Jurkat cell lysate
Background publications Muenzner, Rohde, Kneitz et al.: "CEACAM engagement by human pathogens enhances cell adhesion and counteracts bacteria-induced detachment of epithelial cells." in: The Journal of cell biology, Vol. 170, Issue 5, pp. 825-36, 2005 (PubMed).

Validation Images
back to top