Did you know that you can buy products from over 140 different suppliers from us?

Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7) (Middle Region) antibody

Details for Product No. ABIN310184
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gn6st-4, 2600013M07Rik, C6ST-2, GST5, GST-5, MGC130614
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Dog (Canine), Rat (Rattus), Human
(2)
Host
Rabbit
(2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310184
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CHST7
Sequence DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLL RESIQVLRTR
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against CHST7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name CHST7
Background CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.This gene belongs to the sulfotransferase gene family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This gene product mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of this gene family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes. This gene is part of a gene cluster on chromosome Xp11.23.
Molecular Weight 53 kDa
Gene ID 56548
NCBI Accession NM_019886, NP_063939
UniProt Q9NS84
Research Area Signaling, Metabolism, Extracellular Matrix
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 486 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7) (Middle Region) antibody WB Suggested Anti-CHST7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Product cited in: Thiselton, McDowall, Brandau et al.: "An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders." in: Genomics, Vol. 79, Issue 4, pp. 560-72, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310184
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top