Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310184

Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gn6st-4, 2600013M07Rik, C6ST-2, GST5, GST-5, MGC130614
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310184
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHST7 antibody: synthetic peptide directed towards the middle region of human CHST7
Sequence DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLL RESIQVLRTR
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against CHST7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CHST7
Background CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.This gene belongs to the sulfotransferase gene family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This gene product mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of this gene family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes. This gene is part of a gene cluster on chromosome Xp11.23.
Molecular Weight 53kDa
Gene ID 56548
NCBI Accession NP_063939, NM_019886
UniProt Q9NS84
Research Area Signaling, Metabolism, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHST7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Thiselton, McDowall, Brandau et al.: "An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders." in: Genomics, Vol. 79, Issue 4, pp. 560-72, 2002 (PubMed).

Alternatives for antigen "Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
Beacon