Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310187

gamma-Glutamyltransferase Light Chain 1 (GGTLC1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GGTL6, GGTLA3, GGTLA4, dJ831C21.1, dJ831C21.2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310187
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GGTLA4 antibody: synthetic peptide directed towards the C terminal of human GGTLA4
Sequence DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASD SRKGGEPAGY
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against GGTLA4. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name GGTLA4
Background Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein encoded by this gene is similar in sequence to several members of the gamma-glutamyl transpeptidase family. Three transcript variants encoding the same protein have been found for this gene.
Molecular Weight 25kDa
Gene ID 92086
NCBI Accession NP_563577, NM_080920
UniProt Q9BX51
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GGTLA4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Luong, Hannah, Brown et al.: "Molecular characterization of human acetyl-CoA synthetase, an enzyme regulated by sterol regulatory element-binding proteins." in: The Journal of biological chemistry, Vol. 275, Issue 34, pp. 26458-66, 2000 (PubMed).

Alternatives for antigen "gamma-Glutamyltransferase Light Chain 1 (GGTLC1)", type "Antibodies"
Hosts (2), (1)
Reactivities (2)
Applications (3), (2), (1)
Epitopes (1), (1)
Beacon