gamma-Glutamyltransferase Light Chain 1 (GGTLC1) (C-Term) antibody

Details for Product No. ABIN310187
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms GGTL6, GGTLA3, GGTLA4, dJ831C21.1, dJ831C21.2
Epitope
C-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Xenopus laevis, Human
(3)
Host
Rabbit
(3), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(4), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310187
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human GGTLA4
Sequence DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASD SRKGGEPAGY
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against GGTLA4. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name GGTLA4
Background Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein encoded by this gene is similar in sequence to several members of the gamma-glutamyl transpeptidase family. Three transcript variants encoding the same protein have been found for this gene.
Molecular Weight 25 kDa
Gene ID 92086
NCBI Accession NM_080920, NP_563577
UniProt Q9BX51
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 225 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-gamma-Glutamyltransferase Light Chain 1 (GGTLC1) (C-Term) antibody anti-gamma-Glutamyltransferase Light Chain 1 (GGTLC1) (C-Term) antibody
Background publications Luong, Hannah, Brown et al.: "Molecular characterization of human acetyl-CoA synthetase, an enzyme regulated by sterol regulatory element-binding proteins." in: The Journal of biological chemistry, Vol. 275, Issue 34, pp. 26458-66, 2000 (PubMed).

Hosts (3), (1)
Reactivities (3)
Applications (4), (3), (1), (1)
Epitopes (1), (1)
back to top