Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310191

Aminolevulinate Dehydratase (ALAD) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ALADH, PBGS, Lv, ALADR, aminolevulinatedelta-dehydratase, zgc:110219, DDBDRAFT_0190269, DDBDRAFT_0231415, DDB_0190269, DDB_0231415, ALAD, ncf
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310191
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD
Sequence EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPA IEAIHLLRKT
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Chicken : 92%, Mouse : 92%, Rabbit : 92%, African clawed frog : 84%
Characteristics This is a rabbit polyclonal antibody against ALAD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ALAD
Background The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway, zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway, zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight 39kDa
Gene ID 210
NCBI Accession NP_001003945, NM_001003945
UniProt Q6ZMU0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ALAD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Tang, Breinig, Stith et al.: "Single amino acid mutations alter the distribution of human porphobilinogen synthase quaternary structure isoforms (morpheeins)." in: The Journal of biological chemistry, Vol. 281, Issue 10, pp. 6682-90, 2006 (PubMed).

Alternatives for antigen "Aminolevulinate Dehydratase (ALAD)", type "Antibodies"
Hosts (30), (3)
Reactivities (29), (15), (13), (13), (11), (1)
Applications (24), (9), (5), (4), (3), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (3), (2), (1), (1), (1), (1)
Beacon