Collapsin Response Mediator Protein 1 (CRMP1) (C-Term) antibody

Details for Product No. ABIN310256
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CRMP-1, DPYSL1, DRP-1, DRP1, ULIP-3, CRMP1B, Dpysl1, Ulip3, CRMP1, crmp1, MGC145930, CRMP 1, PCRMP 1, PCRMP-1, PCRMP1, PfCRMP-1
Epitope
C-Term
(18), (13), (4), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(78), (52), (44), (14), (14), (14), (12), (2), (2)
Host
Rabbit
(78), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(75), (36), (30), (14), (10), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310256
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CRMP1
Sequence SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVA PPGGRSNITS
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, African clawed frog : 80 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against CRMP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CRMP1
Background CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants.This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants.
Molecular Weight 62 kDa
Gene ID 1400
NCBI Accession NM_001313, NP_001304
UniProt Q14194
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 572 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Collapsin Response Mediator Protein 1 (CRMP1) (C-Term) antibody WB Suggested Anti-CRMP1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Hosts (78), (6)
Reactivities (78), (52), (44), (14), (14), (14), (12), (2), (2)
Applications (75), (36), (30), (14), (10), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (18), (13), (4), (3), (1), (1), (1), (1), (1), (1), (1), (1)
back to top