Did you know that you can buy products from over 140 different suppliers from us?

Actinin, alpha 4 (ACTN4) (C-Term) antibody

Details for Product No. ABIN310299
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fsgs, fsgs1, C77391, ACTININ-4, FSGS, FSGS1, wu:fb53f05, zgc:63508
Epitope
C-Term
(15), (6), (4), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(65), (20), (20), (13), (13), (12), (1), (1), (1), (1), (1)
Host
Rabbit
(59), (16)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(56), (32), (18), (13), (12), (10), (5), (3), (3), (2), (1), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310299
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ACTN4
Sequence DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRET TDTDTADQVI
Predicted Reactivity Human : 100 %, African clawed frog : 90 %, Bovine : 90 %, Chicken : 90 %, Dog : 90 %, Mouse : 90 %, Rat : 90 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against ACTN4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ACTN4
Background Alpha actinins belong to the spectrin superfamily which is a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis.
Molecular Weight 105 kDa
Gene ID 81
NCBI Accession NM_004924, NP_004915
UniProt O43707
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 911 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Actinin, alpha 4 (ACTN4) (C-Term) antibody WB Suggested Anti-ACTN4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HCT116 cell lysate
anti-Actinin, alpha 4 (ACTN4) (C-Term) antibody (2) WB Suggested Anti-ACTN4
Antibody Titration: 0.2-1 µg/mL
Positive Control: HCT116 cell lysate
ACTN4 is supported by BioGPS gene expression data to be expressed in HCT116
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Validation Images
back to top