Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310377

Alkaline Phosphatase, Placental-Like 2 (ALPPL2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ALPG, GCAP, ALPPL, EAP, Akp5, C77216, D1Ertd816e, RGD1565100, ALPPL2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310377
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the N terminal of human ALPPL2
Sequence MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALG AAKKLQPAQT
Predicted Reactivity Mouse : 81%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against ALPPL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ALPPL2
Background There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The exact physiological function of the alkaline phosphatases is not known. ALPPL2 is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The exact physiological function of the alkaline phosphatases is not known. The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.
Molecular Weight 59kDa
Gene ID 251
NCBI Accession NP_112603, NM_031313
UniProt P10696
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ALPPL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nakano, Shimanuki, Matsushita et al.: "Involvement of intestinal alkaline phosphatase in serum apolipoprotein B-48 level and its association with ABO and secretor blood group types." in: Biochemical and biophysical research communications, Vol. 341, Issue 1, pp. 33-8, 2006 (PubMed).

Alternatives for antigen "Alkaline Phosphatase, Placental-Like 2 (ALPPL2)", type "Antibodies"
Hosts (13), (5)
Reactivities (16)
Applications (18), (5), (4), (3), (3), (3), (1), (1)
Epitopes (4), (3), (2), (2), (2), (1), (1), (1)
Beacon