Alkaline Phosphatase, Placental-Like 2 (ALPPL2) (N-Term) antibody

Details for Product No. ABIN310377
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ALPG, GCAP, ALPPL, EAP, Akp5, C77216, D1Ertd816e, RGD1565100, ALPPL2
Epitope
N-Term
(3), (3), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(20)
Host
Rabbit
(17), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(21), (5), (4), (4), (3), (3), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310377
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ALPPL2
Sequence MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALG AAKKLQPAQT
Predicted Reactivity Mouse : 81 %, Rat : 71 %
Characteristics This is a rabbit polyclonal antibody against ALPPL2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ALPPL2
Background There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The exact physiological function of the alkaline phosphatases is not known. ALPPL2 is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The exact physiological function of the alkaline phosphatases is not known. The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.
Molecular Weight 59 kDa
Gene ID 251
NCBI Accession NM_031313, NP_112603
UniProt P10696
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 532 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Alkaline Phosphatase, Placental-Like 2 (ALPPL2) (N-Term) antibody WB Suggested Anti-ALPPL2 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Background publications Nakano, Shimanuki, Matsushita et al.: "Involvement of intestinal alkaline phosphatase in serum apolipoprotein B-48 level and its association with ABO and secretor blood group types." in: Biochemical and biophysical research communications, Vol. 341, Issue 1, pp. 33-8, 2006 (PubMed).

Hosts (17), (5)
Reactivities (20)
Applications (21), (5), (4), (4), (3), (3), (1), (1), (1)
Epitopes (3), (3), (2), (2), (2), (1), (1), (1), (1)
back to top