Did you know that you can buy products from over 140 different suppliers from us?

Iroquois Homeobox 3 (IRX3) (C-Term) antibody

Details for Product No. ABIN310393
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI894186, IRX-1, IRXB1, iro3, irx3b, xiro-3, xiro3
Epitope
C-Term
(12), (7), (6), (4), (3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(57), (23), (13), (12), (12), (11)
Host
Rabbit
(39), (20)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(37), (29), (16), (9), (7), (6), (6), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310393
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human IRX3
Sequence SPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGPRLHPL SLLGSAPPHL
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Pig : 90 %, Horse : 80 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against IRX3. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name IRX3
Background IRX3 is a member of the Iroquois homeobox gene family that encodes a protein known for its essential role in spinal cord development.
Molecular Weight 52 kDa
Gene ID 79191
NCBI Accession NM_024336, NP_077312
UniProt P78415
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 501 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Iroquois Homeobox 3 (IRX3) (C-Term) antibody WB Suggested Anti-IRX3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Lewis, Ross, Strickland et al.: "Regulated expression patterns of IRX-2, an Iroquois-class homeobox gene, in the human breast." in: Cell and tissue research, Vol. 296, Issue 3, pp. 549-54, 1999 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310393
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top