Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310414

Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms E2-F1, L-UBC, UBCH7, UbcM4, C79827, Ubce7, UBE2L3, ube2l3l, wu:fb38h03
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310414
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UBE2L3 antibody: synthetic peptide directed towards the C terminal of human UBE2L3
Sequence IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFT KKYGEKRPVD
Predicted Reactivity African clawed frog : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against UBE2L3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UBE2L3
Background UBE2L3(ubiquitin-conjugating enzyme E2L 3) Antibody The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Weight 17kDa
Gene ID 7332
NCBI Accession NP_003338, NM_003347
UniProt P68036
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UBE2L3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3)", type "Antibodies"
Hosts (37), (8), (4)
Reactivities (45), (23), (22), (16), (2), (2), (2), (2), (2), (1)
Applications (39), (20), (12), (10), (6), (6), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (4), (2), (2), (2), (1), (1), (1)
Beacon