Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2) (Middle Region) antibody

Details for Product No. ABIN310517
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms OATP, OATP-A, OATP1A2, SLC21A3
Epitope
Middle Region
(4), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(13), (1)
Host
Rabbit
(15)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (9), (1)
Pubmed 1 reference available
Catalog no. ABIN310517
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SLCO1A2
Sequence AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWV GAWWFGFLIC
Predicted Reactivity Human : 100 %, Pig : 90 %, Rabbit : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against SLCO1A2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLCO1A2
Background SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.
Molecular Weight 64 kDa
Gene ID 6579
NCBI Accession NM_005075, NP_005066
UniProt P46721-2
Research Area Ion Channels, Transporters
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 579 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2) (Middle Region) antibody WB Suggested Anti-SLCO1A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Lee, Glaeser, Smith et al.: "Polymorphisms in human organic anion-transporting polypeptide 1A2 (OATP1A2): implications for altered drug disposition and central nervous system drug entry." in: The Journal of biological chemistry, Vol. 280, Issue 10, pp. 9610-7, 2005 (PubMed).

Hosts (15)
Reactivities (13), (1)
Applications (15), (9), (1)
Epitopes (4), (2), (1), (1)
back to top