Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310517

Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OATP, OATP-A, OATP1A2, SLC21A3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310517
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLCO1A2 antibody: synthetic peptide directed towards the middle region of human SLCO1A2
Sequence AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWV GAWWFGFLIC
Predicted Reactivity Human : 100%, Pig : 92%, Rabbit : 92%, Bovine : 85%
Characteristics This is a rabbit polyclonal antibody against SLCO1A2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLCO1A2
Background SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.
Molecular Weight 64kDa
Gene ID 6579
NCBI Accession NP_005066, NM_005075
UniProt P46721-2
Research Area Ion Channels, Transporters
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLCO1A2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lee, Glaeser, Smith et al.: "Polymorphisms in human organic anion-transporting polypeptide 1A2 (OATP1A2): implications for altered drug disposition and central nervous system drug entry." in: The Journal of biological chemistry, Vol. 280, Issue 10, pp. 9610-7, 2005 (PubMed).

Alternatives for antigen "Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2)", type "Antibodies"
Hosts (13)
Reactivities (11), (1)
Applications (13), (7)
Epitopes (3), (2), (1)
Beacon